PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00026574-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 212aa    MW: 24125.3 Da    PI: 10.3768
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00026574-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.81.8e-112770247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      g +++eEd ++    +  G++ W+ Ia+ ++  Rt++++k++w++ 
  PSME_00026574-RA 27 GGFSEEEDNIICSIYNNIGSR-WSIIAAQLP-ARTDNDIKNYWNTT 70
                      569******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.437120IPR017877Myb-like domain
SuperFamilySSF466898.32E-21677IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-12632IPR009057Homeodomain-like
PROSITE profilePS5129419.6132175IPR017930Myb domain
SMARTSM007175.3E-92573IPR001005SANT/Myb domain
PfamPF002491.3E-102770IPR001005SANT/Myb domain
CDDcd001672.28E-72971No hitNo description
Gene3DG3DSA:1.10.10.602.3E-183372IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
LNTGLKRCGK SCRLRWLNYL RPNIKHGGFS EEEDNIICSI YNNIGSRWSI IAAQLPARTD  60
NDIKNYWNTT LKKKLSRKGK DRQARHLAAA KQQNHEDLQS YNTSELNRSP NIYGPQQQPV  120
GVVHHMNIDC MNGPYSNFGN GISSEPATFQ LNHQEVFDQE VSDRNGRASS HAPFVKRSKT  180
KKGRVAAEKV KRRLIGCSIL NLLFFLYGQQ VP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-1977537105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175181KRSKTKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007014145.11e-45Myb domain protein 36
TrEMBLD5ABB65e-68D5ABB6_PICSI; Putative uncharacterized protein
STRINGVIT_00s1352g00010.t011e-43(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.14e-44myb domain protein 84